SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22456_internal:A_BomaMG_comp30758_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003779 F actin binding
GO:0005200 F structural constituent of cytoskeleton
GO:0005516 F calmodulin binding
GO:0005543 F phospholipid binding
GO:0005546 F phosphatidylinositol-4,5-bisphosphate binding
GO:0005737 C cytoplasm
GO:0005811 C lipid droplet
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0007009 P plasma membrane organization
GO:0007026 P negative regulation of microtubule depolymerization
GO:0007274 P neuromuscular synaptic transmission
GO:0007399 P nervous system development
GO:0007409 P axonogenesis
GO:0007411 P axon guidance
GO:0008017 F microtubule binding
GO:0008091 C spectrin
GO:0008092 F cytoskeletal protein binding
GO:0016199 P axon midline choice point recognition
GO:0016327 C apicolateral plasma membrane
GO:0016328 C lateral plasma membrane
GO:0030424 C axon
GO:0030506 F ankyrin binding
GO:0030721 P spectrosome organization
GO:0031594 C neuromuscular junction
GO:0042062 P long-term strengthening of neuromuscular junction
GO:0045169 C fusome
GO:0045170 C spectrosome
GO:0045478 P fusome organization
GO:0048790 P maintenance of presynaptic active zone structure
GO:0050807 P regulation of synapse organization
GO:0051693 P actin filament capping
GO:0072499 P photoreceptor cell axon guidance
RNA-seq EntryA_BomaMG_comp30758_c0_seq1
Sequence
(Amino Acid)
ACRARRAKLEDADRLYRFLSQVRTLTLWMDDVVRQMNTGEKPRDVSGVELLMNNHQSLKA
EIDTREDNFSACISLGKELLARQHYASADIKEKLLQLTNQRNALLRRWEERWENLQLILE
VYQFARDAAVAEAWLIAQEPYLMSQELGHTIDEVESLIKKHEAFEKSAAAQEDRFSALQR
LTTFEVKEMKRRQEAAEAAEREKREREAAEAAAAA
(70 a.a.)

- SilkBase 1999-2023 -