SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG22380_complete:A_BomaMG_comp28136_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000125 C SAGA complex
GO:0001889 P liver development
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0005634 C nucleus
GO:0005669 C transcription factor TFIID complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006352 P DNA-templated transcription, initiation
GO:0006355 P regulation of transcription, DNA-templated
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006915 P apoptotic process
GO:0010468 P regulation of gene expression
GO:0016578 P histone deubiquitination
GO:0019899 F enzyme binding
GO:0030331 F estrogen receptor binding
GO:0030914 C SAGA complex
GO:0033276 C transcription factor TFTC complex
GO:0035264 P multicellular organism growth
GO:0043623 P protein-containing complex assembly
GO:0043966 P histone H3 acetylation
GO:0048471 C perinuclear region of cytoplasm
GO:0051101 P regulation of DNA binding
GO:0051260 P protein homooligomerization
GO:0070063 F RNA polymerase binding
GO:0070365 P hepatocyte differentiation
RNA-seq EntryA_BomaMG_comp28136_c0_seq1
Sequence
(Amino Acid)
MQMSRIGSPSVGMDDDGCAGHALGDFLLQLENYNPSIPDSVVAYYLNLTGFESQDPRLVR
LIALASQKFLSDIVNDALQHCKMRTSNQINQSSKNQKGPKEKKYVMTMDDLAPALQEYGI
TAKKPHYFV
*(42 a.a.)

- SilkBase 1999-2023 -