SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG22252_5prime_partial:A_BomaMG_comp26450_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001889 P liver development
GO:0004029 F aldehyde dehydrogenase (NAD+) activity
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0005759 C mitochondrial matrix
GO:0006068 P ethanol catabolic process
GO:0008152 P metabolic process
GO:0016491 F oxidoreductase activity
GO:0016620 F oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0032355 P response to estradiol
GO:0032496 P response to lipopolysaccharide
GO:0032570 P response to progesterone
GO:0032870 P cellular response to hormone stimulus
GO:0033574 P response to testosterone
GO:0035094 P response to nicotine
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0055093 P response to hyperoxia
GO:0055114 P obsolete oxidation-reduction process
GO:0070404 F NADH binding
GO:0071398 P cellular response to fatty acid
RNA-seq EntryA_BomaMG_comp26450_c0_seq1
Sequence
(Amino Acid)
AAGGGAAPGPGYFVQPTVFCDVTDDMDIAKTEIFGPVQQILKFSQFDEVVERANNSEYGL
AAAVFTKDLDKANYFVQRLRAGTVWVNDYNVFGNQVPFGGFKQSGLGRENGPYGLRNYLE
VKAVVVKLADKNT
*(43 a.a.)

- SilkBase 1999-2023 -