SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG22038_5prime_partial:A_BomaMG_comp25848_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000014 F single-stranded DNA endodeoxyribonuclease activity
GO:0000729 P DNA double-strand break processing
GO:0000737 P DNA catabolic process, endonucleolytic
GO:0000793 C condensed chromosome
GO:0003677 F DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003697 F single-stranded DNA binding
GO:0003824 F catalytic activity
GO:0004518 F nuclease activity
GO:0004519 F endonuclease activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0006281 P DNA repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006974 P cellular response to DNA damage stimulus
GO:0008152 P metabolic process
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0008283 P cell population proliferation
GO:0010452 P histone H3-K36 methylation
GO:0015074 P DNA integration
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0016787 F hydrolase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0031297 P replication fork processing
GO:0032259 P methylation
GO:0034968 P histone lysine methylation
GO:0035861 C site of double-strand break
GO:0042800 F histone methyltransferase activity (H3-K4 specific)
GO:0042803 F protein homodimerization activity
GO:0043566 F DNA binding
GO:0044547 F DNA topoisomerase binding
GO:0044774 P mitotic DNA integrity checkpoint signaling
GO:0046872 F metal ion binding
GO:0046975 F histone methyltransferase activity (H3-K36 specific)
GO:0051568 P histone H3-K4 methylation
GO:0071157 P regulation of cell cycle
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:0097676 P histone H3-K36 dimethylation
GO:2000373 P positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity
GO:2001034 P positive regulation of double-strand break repair via nonhomologous end joining
GO:2001251 P negative regulation of chromosome organization
RNA-seq EntryA_BomaMG_comp25848_c0_seq3
Sequence
(Amino Acid)
FTTKKIKMQRKPRKKFAMFMDLMSVRVAQIWFKRFQSGNFDVKDARRSGRPITDKMDAIF
EKVEQDRHITSYEVAEELGINHKTILAHLKKTGYTKKLDIWVPHELTERNLMNRVLICDF
LLRRSETEPFLKKLITGDEKWITYDKNVRKRSWSKAGQASQTVAKPGLTRNKVMLCVWWD
WKDIIHYELLPPGRTIDD
*(65 a.a.)

- SilkBase 1999-2023 -