SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG21_internal:A_BomaMG_comp721_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005938 C cell cortex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0008407 P chaeta morphogenesis
GO:0016055 P Wnt signaling pathway
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030427 C site of polarized growth
GO:0035316 P non-sensory hair organization
GO:0035317 P imaginal disc-derived wing hair organization
GO:0042052 P rhabdomere development
GO:0044297 C cell body
GO:0045177 C apical part of cell
GO:0045860 P positive regulation of protein kinase activity
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048601 P oocyte morphogenesis
GO:0048800 P antennal morphogenesis
GO:0048814 P regulation of dendrite morphogenesis
GO:0050773 P regulation of dendrite development
GO:0070593 P dendrite self-avoidance
GO:0090527 P actin filament reorganization
RNA-seq EntryA_BomaMG_comp721_c0_seq1
Sequence
(Amino Acid)
KKTFANSASALENGGLHTNIAEYLDGVRQCFEAEAEKDAPAAREQRITFADFVTELIKSF
PLEMYASLMKKELCKSLFSLFSGWCGPLAKHLGSLVPQITAQEVDARLNLSA
(36 a.a.)

- SilkBase 1999-2023 -