SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG21838_complete:A_BomaMG_comp25832_c1_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001525 P angiogenesis
GO:0001666 P response to hypoxia
GO:0001935 P endothelial cell proliferation
GO:0002246 P wound healing involved in inflammatory response
GO:0002686 P negative regulation of leukocyte migration
GO:0004392 F heme oxygenase (decyclizing) activity
GO:0004630 F phospholipase D activity
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005829 C cytosol
GO:0005901 C caveola
GO:0006788 P heme oxidation
GO:0006879 P cellular iron ion homeostasis
GO:0006915 P apoptotic process
GO:0006979 P response to oxidative stress
GO:0007264 P small GTPase mediated signal transduction
GO:0007588 P excretion
GO:0008217 P regulation of blood pressure
GO:0008219 P cell death
GO:0008285 P negative regulation of cell population proliferation
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010656 P negative regulation of muscle cell apoptotic process
GO:0014806 P smooth muscle hyperplasia
GO:0016020 C membrane
GO:0016491 F oxidoreductase activity
GO:0019899 F enzyme binding
GO:0020037 F heme binding
GO:0031670 P cellular response to nutrient
GO:0032764 P negative regulation of mast cell cytokine production
GO:0034101 P erythrocyte homeostasis
GO:0034383 P low-density lipoprotein particle clearance
GO:0034395 P regulation of transcription from RNA polymerase II promoter in response to iron
GO:0034605 P cellular response to heat
GO:0035094 P response to nicotine
GO:0035556 P intracellular signal transduction
GO:0042167 P heme catabolic process
GO:0042168 P heme metabolic process
GO:0042542 P response to hydrogen peroxide
GO:0042803 F protein homodimerization activity
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043231 C intracellular membrane-bounded organelle
GO:0043305 P negative regulation of mast cell degranulation
GO:0043392 P negative regulation of DNA binding
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043619 P regulation of transcription from RNA polymerase II promoter in response to oxidative stress
GO:0043627 P response to estrogen
GO:0045080 P positive regulation of chemokine production
GO:0045765 P regulation of angiogenesis
GO:0045766 P positive regulation of angiogenesis
GO:0045909 P vasodilation
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0048662 P negative regulation of smooth muscle cell proliferation
GO:0051090 P regulation of DNA-binding transcription factor activity
GO:0051260 P protein homooligomerization
GO:0055072 P iron ion homeostasis
GO:0055114 P obsolete oxidation-reduction process
GO:0071243 P cellular response to arsenic-containing substance
GO:0071276 P cellular response to cadmium ion
GO:0071456 P cellular response to hypoxia
GO:1902042 P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
RNA-seq EntryA_BomaMG_comp25832_c1_seq3
Sequence
(Amino Acid)
MSEQDLFTTRMRKATRKIHSVSDALVNAKFAISLRDHTVWGGGLFVFYHIFAYLEDAKER
LNMSEFNKLFVHEILYRKKAFEQDLQHYLGDNWRSIPKSLALENYLQHLQDLERDNPKLL
MAYVYHLYLGLLSGGQILSKKRRVFGEKNEQPNTYVDKVTDFAAVDINKLKNEFREAMNQ
IATTMSSEEQATFIEESNQVFIMNNLIVNSVEGQNKVLYGLLCKASAVVFVVASLLFAYK
LHRG
*(80 a.a.)

- SilkBase 1999-2023 -