SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG2151_3prime_partial:A_BomaMG_comp13318_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_ankyrin_repeat_domain-containing_protein_17-like_[Bombyx_mori]
Ontology
GO:0000785 C chromatin
GO:0001955 P blood vessel maturation
GO:0002376 P immune system process
GO:0003676 F nucleic acid binding
GO:0003682 F chromatin binding
GO:0003723 F RNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006275 P regulation of DNA replication
GO:0007492 P endoderm development
GO:0016020 C membrane
GO:0042742 P defense response to bacterium
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0044822 F RNA binding
GO:0045087 P innate immune response
GO:0045787 P positive regulation of cell cycle
GO:0051151 P negative regulation of smooth muscle cell differentiation
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
GO:1900245 P positive regulation of MDA-5 signaling pathway
GO:1900246 P positive regulation of RIG-I signaling pathway
RNA-seq EntryA_BomaMG_comp13318_c0_seq2
Sequence
(Amino Acid)
MRSDQPAPHHRHHHQEKNFSQPCGVTATGSTPAVPSSVGADGAPSLVEACSDGDVGTVRK
LLTEGRSVHETTEEGEPLLSLACSAGYYELAQVLLAMHASVEDRGIKGDCTPLMEAASAG
HVDIVRLLLAHGAD
(43 a.a.)

- SilkBase 1999-2023 -