SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG21159_internal:A_BomaMG_comp25810_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000045 P autophagosome assembly
GO:0000407 C phagophore assembly site
GO:0001889 P liver development
GO:0001934 P positive regulation of protein phosphorylation
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006914 P autophagy
GO:0007049 P cell cycle
GO:0007254 P JNK cascade
GO:0007507 P heart development
GO:0010506 P regulation of autophagy
GO:0016236 P macroautophagy
GO:0019901 F protein kinase binding
GO:0031965 C nuclear membrane
GO:0034045 C phagophore assembly site membrane
GO:0043066 P negative regulation of apoptotic process
GO:0045793 P positive regulation of cell size
GO:1990316 C Atg1/ULK1 kinase complex
GO:2001237 P negative regulation of extrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaMG_comp25810_c2_seq1
Sequence
(Amino Acid)
RAVHECARRRTFSTHHLKWATELAEKLLKIHDEEVRRRQEFNELFEGHFLRSLFPGLTDL
PPAFSTQAPPVFDDRLPKITDTDVEFILNSFPDLAKDVPQYDMEATVKFFQQRLSAINQE
DN
(39 a.a.)

- SilkBase 1999-2023 -