SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG20899_3prime_partial:A_BomaMG_comp25795_c8_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000786 C nucleosome
GO:0003677 F DNA binding
GO:0003713 F transcription coactivator activity
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005794 C Golgi apparatus
GO:0006323 P DNA packaging
GO:0006334 P nucleosome assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006473 P protein acetylation
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0016407 F acetyltransferase activity
GO:0016568 P chromatin organization
GO:0016573 P histone acetylation
GO:0016605 C PML body
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0016747 F acyltransferase activity, transferring groups other than amino-acyl groups
GO:0030099 P myeloid cell differentiation
GO:0043966 P histone H3 acetylation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048513 P animal organ development
GO:0070776 C MOZ/MORF histone acetyltransferase complex
GO:0090398 P cellular senescence
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomaMG_comp25795_c8_seq3
Sequence
(Amino Acid)
MCDPDEVGKEVWKRWILEAIHKIRSQKQRPSVERICHAIRQHHNYHEDIVSERLERAVRE
GVVLKVYNKGQSSYKDPGGMQNRTLRLAPNVDISRPVAKIVRELGERDGSTLKSIERHLY
QAYQIIVSPDVDVKAILRAAVKRAVARGLLSHHAGAYVVADSSNNTSSDRSSKQKKHSQD
SSEEKQVQGGVPVCSECLGTDTKNQSGIAESLICCSQCKSYAHPSCLDLLDHVTQTTVKT
SRWSCGECATCLVCGAGGAWATRCAVRCGRHAHP
(90 a.a.)

- SilkBase 1999-2023 -