SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG206_internal:A_BomaMG_comp2168_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
serine_protease_inhibitor_10_precursor_[Bombyx_mori]
Ontology
GO:0001972 F retinoic acid binding
GO:0002020 F protease binding
GO:0002080 C acrosomal membrane
GO:0004867 F serine-type endopeptidase inhibitor activity
GO:0005515 F protein binding
GO:0005539 F glycosaminoglycan binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0007283 P spermatogenesis
GO:0007338 P single fertilization
GO:0007342 P fusion of sperm to egg plasma membrane involved in single fertilization
GO:0007596 P blood coagulation
GO:0008201 F heparin binding
GO:0009897 C external side of plasma membrane
GO:0010466 P negative regulation of peptidase activity
GO:0010951 P negative regulation of endopeptidase activity
GO:0016020 C membrane
GO:0030414 F peptidase inhibitor activity
GO:0031091 C platelet alpha granule
GO:0031094 C platelet dense tubular network
GO:0031210 F phosphatidylcholine binding
GO:0032190 F acrosin binding
GO:0036024 C protein C inhibitor-TMPRSS7 complex
GO:0036025 C protein C inhibitor-TMPRSS11E complex
GO:0036026 C protein C inhibitor-PLAT complex
GO:0036027 C protein C inhibitor-PLAU complex
GO:0036028 C protein C inhibitor-thrombin complex
GO:0036029 C protein C inhibitor-KLK3 complex
GO:0036030 C protein C inhibitor-plasma kallikrein complex
GO:0043234 C protein-containing complex
GO:0045861 P negative regulation of proteolysis
GO:0051346 P negative regulation of hydrolase activity
GO:0070062 C extracellular exosome
GO:0097181 C protein C inhibitor-coagulation factor V complex
GO:0097182 C protein C inhibitor-coagulation factor Xa complex
GO:0097183 C protein C inhibitor-coagulation factor XI complex
RNA-seq EntryA_BomaMG_comp2168_c0_seq1
Sequence
(Amino Acid)
RCARLILVPRSRDGLTRLIADLPSVTLQDIEDSMKKEELLLSMPTFYVETTTKPIVSLVK
FGVSKIFTHEADLSGVSSDGGLFVEEMAQHVSVRVDNSDSVASEMSAAN
(35 a.a.)

- SilkBase 1999-2023 -