SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG20509_3prime_partial:A_BomaMG_comp25776_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004697 F protein kinase C activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0010976 P positive regulation of neuron projection development
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0034351 P negative regulation of glial cell apoptotic process
GO:0035556 P intracellular signal transduction
GO:0043524 P negative regulation of neuron apoptotic process
GO:0046872 F metal ion binding
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0060252 P positive regulation of glial cell proliferation
GO:2000353 P positive regulation of endothelial cell apoptotic process
RNA-seq EntryA_BomaMG_comp25776_c0_seq2
Sequence
(Amino Acid)
MMPTQLVNQDNHVNDVRVKTVYNGDVMITYINHNITFEEFTHEMVATCRFAPDQVFTMKW
VDEEGDPCTISTQLELDESLRLYELNRDSELTVHVFPNVPAAPGMPCAGEDRSIYRRGA
(38 a.a.)

- SilkBase 1999-2023 -