SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG198_internal:A_BomaMG_comp2085_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
hypothetical_protein_KGM_02829_[Danaus_plexippus]
Ontology
GO:0000166 F nucleotide binding
GO:0001726 C ruffle
GO:0003774 F cytoskeletal motor activity
GO:0003779 F actin binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005547 F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006810 P transport
GO:0008152 P metabolic process
GO:0008360 P regulation of cell shape
GO:0016020 C membrane
GO:0016459 C myosin complex
GO:0022409 P positive regulation of cell-cell adhesion
GO:0030027 C lamellipodium
GO:0030175 C filopodium
GO:0030507 F spectrin binding
GO:0030705 P cytoskeleton-dependent intracellular transport
GO:0030898 F microfilament motor activity
GO:0031527 C filopodium membrane
GO:0032433 C filopodium tip
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0051015 F actin filament binding
GO:0051489 P regulation of filopodium assembly
GO:0060002 F plus-end directed microfilament motor activity
RNA-seq EntryA_BomaMG_comp2085_c0_seq1
Sequence
(Amino Acid)
PRLGANEFGIKHYAGQVWYNVEGFLDKNRDALRADVLELLCSSDVPLVAEMSTQLRAQHD
ANKTLPRGANGRFVTMKPRTPTVAARFSDSLHQLLESMSRCNPWFVRCIKP
(36 a.a.)

- SilkBase 1999-2023 -