SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG19827_5prime_partial:A_BomaMG_comp25715_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000430 P regulation of transcription from RNA polymerase II promoter by glucose
GO:0000432 P positive regulation of transcription from RNA polymerase II promoter by glucose
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0007595 P lactation
GO:0019086 P late viral transcription
GO:0042803 F protein homodimerization activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0043425 F bHLH transcription factor binding
GO:0043565 F sequence-specific DNA binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0055088 P lipid homeostasis
RNA-seq EntryA_BomaMG_comp25715_c0_seq3
Sequence
(Amino Acid)
LDTNENTTAYHFKDISGTVTYKLITMTGEENVANASPSPPHNFPDAEYYVISNPVDVFGP
SAAAKKPIRRDPLQAKAVSTKKRDDKRRATHNEVERRRRDKINSWITKLAAMVPNSGMPD
SASKGGILAKACDHIADLTEKQKRLEKLELDNKKLVFEILRLNQELTEVRKENSSMRNQL
ADNCVVIPKKSKDPKS
*(64 a.a.)

- SilkBase 1999-2023 -