SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG19311_complete:A_BomaMG_comp25664_c1_seq8
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000989 F obsolete transcription factor activity, transcription factor binding
GO:0001076 F obsolete transcription factor activity, RNA polymerase II transcription factor binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001228 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001525 P angiogenesis
GO:0001568 P blood vessel development
GO:0001666 P response to hypoxia
GO:0001755 P neural crest cell migration
GO:0001837 P epithelial to mesenchymal transition
GO:0001892 P embryonic placenta development
GO:0001922 P B-1 B cell homeostasis
GO:0001944 P vasculature development
GO:0001947 P heart looping
GO:0002052 P positive regulation of neuroblast proliferation
GO:0002248 P connective tissue replacement involved in inflammatory response wound healing
GO:0003151 P outflow tract morphogenesis
GO:0003208 P cardiac ventricle morphogenesis
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006089 P lactate metabolic process
GO:0006110 P regulation of glycolytic process
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006879 P cellular iron ion homeostasis
GO:0006953 P acute-phase response
GO:0007165 P signal transduction
GO:0007595 P lactation
GO:0008134 F transcription factor binding
GO:0008284 P positive regulation of cell population proliferation
GO:0008542 P visual learning
GO:0009612 P response to mechanical stimulus
GO:0009651 P response to salt stress
GO:0009749 P response to glucose
GO:0010165 P response to X-ray
GO:0010468 P regulation of gene expression
GO:0010508 P positive regulation of autophagy
GO:0010573 P vascular endothelial growth factor production
GO:0010575 P positive regulation of vascular endothelial growth factor production
GO:0010628 P positive regulation of gene expression
GO:0010634 P positive regulation of epithelial cell migration
GO:0010870 P obsolete positive regulation of receptor biosynthetic process
GO:0010996 P response to auditory stimulus
GO:0014074 P response to purine-containing compound
GO:0014823 P response to activity
GO:0014850 P response to muscle activity
GO:0016239 P positive regulation of macroautophagy
GO:0016607 C nuclear speck
GO:0019896 P axonal transport of mitochondrion
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0021502 P neural fold elevation formation
GO:0021987 P cerebral cortex development
GO:0030154 P cell differentiation
GO:0030279 P negative regulation of ossification
GO:0030424 C axon
GO:0030502 P negative regulation of bone mineralization
GO:0030949 P positive regulation of vascular endothelial growth factor receptor signaling pathway
GO:0031514 C motile cilium
GO:0031625 F ubiquitin protein ligase binding
GO:0032007 P negative regulation of TOR signaling
GO:0032025 P response to cobalt ion
GO:0032355 P response to estradiol
GO:0032364 P oxygen homeostasis
GO:0032403 F protein-containing complex binding
GO:0032869 P cellular response to insulin stimulus
GO:0032909 P regulation of transforming growth factor beta2 production
GO:0032963 P collagen metabolic process
GO:0035035 F histone acetyltransferase binding
GO:0035162 P embryonic hemopoiesis
GO:0035257 F nuclear receptor binding
GO:0035690 P cellular response to xenobiotic stimulus
GO:0035774 P positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0042127 P regulation of cell population proliferation
GO:0042493 P response to xenobiotic stimulus
GO:0042541 P hemoglobin biosynthetic process
GO:0042593 P glucose homeostasis
GO:0042826 F histone deacetylase binding
GO:0043065 P positive regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043279 P response to alkaloid
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043565 F sequence-specific DNA binding
GO:0043619 P regulation of transcription from RNA polymerase II promoter in response to oxidative stress
GO:0043627 P response to estrogen
GO:0045648 P positive regulation of erythrocyte differentiation
GO:0045766 P positive regulation of angiogenesis
GO:0045793 P positive regulation of cell size
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045906 P negative regulation of vasoconstriction
GO:0045926 P negative regulation of growth
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046716 P muscle cell cellular homeostasis
GO:0046886 P positive regulation of hormone biosynthetic process
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0048514 P blood vessel morphogenesis
GO:0048546 P digestive tract morphogenesis
GO:0048593 P camera-type eye morphogenesis
GO:0048661 P positive regulation of smooth muscle cell proliferation
GO:0050790 P regulation of catalytic activity
GO:0051216 P cartilage development
GO:0051384 P response to glucocorticoid
GO:0051541 P elastin metabolic process
GO:0051879 F Hsp90 protein binding
GO:0060135 P maternal process involved in female pregnancy
GO:0060574 P intestinal epithelial cell maturation
GO:0060992 P response to fungicide
GO:0061030 P epithelial cell differentiation involved in mammary gland alveolus development
GO:0061072 P iris morphogenesis
GO:0061298 P retina vasculature development in camera-type eye
GO:0061419 P positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0070243 P regulation of thymocyte apoptotic process
GO:0070244 P negative regulation of thymocyte apoptotic process
GO:0070301 P cellular response to hydrogen peroxide
GO:0071222 P cellular response to lipopolysaccharide
GO:0071245 P cellular response to carbon monoxide
GO:0071250 P cellular response to nitrite
GO:0071257 P cellular response to electrical stimulus
GO:0071260 P cellular response to mechanical stimulus
GO:0071279 P cellular response to cobalt ion
GO:0071333 P cellular response to glucose stimulus
GO:0071347 P cellular response to interleukin-1
GO:0071396 P cellular response to lipid
GO:0071407 P cellular response to organic cyclic compound
GO:0071456 P cellular response to hypoxia
GO:0071482 P cellular response to light stimulus
GO:0071542 P dopaminergic neuron differentiation
GO:0072347 P response to anesthetic
GO:0090575 C RNA polymerase II transcription regulator complex
GO:0097237 P cellular response to toxic substance
GO:0097411 P hypoxia-inducible factor-1alpha signaling pathway
GO:1900037 P regulation of cellular response to hypoxia
GO:1902895 P positive regulation of miRNA transcription
GO:1903377 P negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway
GO:1903599 P positive regulation of autophagy of mitochondrion
GO:1903715 P regulation of aerobic respiration
GO:1903928 P cellular response to cyanide
GO:1904115 C axon cytoplasm
GO:2000378 P negative regulation of reactive oxygen species metabolic process
GO:2001054 P negative regulation of mesenchymal cell apoptotic process
RNA-seq EntryA_BomaMG_comp25664_c1_seq8
Sequence
(Amino Acid)
MSTKPANQKRRNNEKRKEKSRVAARCRRTKEMQIFSELTAALPAKKEEVEQLDKASVMRL
AISYLRVRDVVSMLPDVNSDQSKMQNPEGFEELASELSYMRALDGFVLVLSQQGDIVYCS
DNIAEHLGVSQMEIMGQSVFEFSHPCDHDEIREALRTNGGARRDLLLRLKCTLTSKGRNV
HLKSASYKVIHITGHMLASTEDNERNNNETKADEEKKGKAGCLVAVGRPIPHPSNIEIPL
DSKTFLSKHSLDMKFTYVDESLLNTLGFGSEELVGRSLYDYHHAADSASMIQQFKSLFSK
GQCETGQYRFLAKSGGYSWVQTQATVITDKQQKPISVVCVNYIISGIECKDEVFAAHQVQ
HADLKPKLSAVASPGVTFRAPVEPLANGAIVAIVPPEEERPIPVTELIFAPRKKEMNKGF
LMFSQDEGLTMLKDEPEDLTHLAPTAGDACIPLENSPFDMFDEFILSDNYCSLLGDDLAN
GSPVDPLAPDPSLLSSPESQENDSSCEQSSLLTELSLDAFDNTRSDEIDDSNSPFIPISD
ELPVLEPAVMWGALPDSVSQARPQPSETHTSPAPALQRLLTGPPPQDLITSIYSDQGLMP
SRSISTWDTGVKRVMKEEEEPSAKRVKRSPSPVAPKPKSQSSSVLMNLLVSGCDVDAGYI
CMVQCRPRQKAKA
*(223 a.a.)

- SilkBase 1999-2023 -