| Name | O_BomaMG1928_internal:A_BomaMG_comp13012_c0_seq1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | hypothetical_protein_KGM_15584_[Danaus_plexippus] |
| Ontology |
| GO:0005737 |
C |
cytoplasm |
| GO:0005765 |
C |
lysosomal membrane |
| GO:0005768 |
C |
endosome |
| GO:0005769 |
C |
early endosome |
| GO:0005829 |
C |
cytosol |
| GO:0006897 |
P |
endocytosis |
| GO:0010008 |
C |
endosome membrane |
| GO:0016020 |
C |
membrane |
| GO:0016023 |
C |
cytoplasmic vesicle |
| GO:0017137 |
F |
small GTPase binding |
| GO:0030904 |
C |
retromer complex |
| GO:0031410 |
C |
cytoplasmic vesicle |
| GO:0032439 |
P |
endosomal transport |
| GO:0034058 |
P |
endosomal vesicle fusion |
| GO:0042147 |
P |
retrograde transport, endosome to Golgi |
| GO:0044354 |
C |
macropinosome |
| GO:0046872 |
F |
metal ion binding |
| GO:0048549 |
P |
positive regulation of pinocytosis |
| GO:0070062 |
C |
extracellular exosome |
| GO:0090160 |
P |
Golgi to lysosome transport |
| GO:1901981 |
F |
phosphatidylinositol phosphate binding |
|
| RNA-seq Entry | A_BomaMG_comp13012_c0_seq1 |
Sequence
(Amino Acid) | AGPAGEGADLAADKQTPLHLCCTWGLTEVIQTLLEHGANINAKDSEGKTPLHIAIENQHA
AIISLLLTQPNIDLSARDNKGVSPFAAALIARNNKAAQAILEKNPSAAEQVDKKGRNFLH
VAIQTCDMESVMFLLSVEVDVNSRVQDATLAPPLHLAASAGNEVLLRSLLL
(56 a.a.) |
