SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG19014_complete:A_BomaMG_comp25643_c6_seq6
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0001578 P microtubule bundle formation
GO:0001933 P negative regulation of protein phosphorylation
GO:0004860 F protein kinase inhibitor activity
GO:0005215 F transporter activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005793 C endoplasmic reticulum-Golgi intermediate compartment
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006469 P negative regulation of protein kinase activity
GO:0006611 P protein export from nucleus
GO:0006810 P transport
GO:0008017 F microtubule binding
GO:0010923 P negative regulation of phosphatase activity
GO:0012505 C endomembrane system
GO:0015031 P protein transport
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0017156 P calcium-ion regulated exocytosis
GO:0019722 P calcium-mediated signaling
GO:0019900 F kinase binding
GO:0022406 P membrane docking
GO:0030133 C transport vesicle
GO:0031122 P cytoplasmic microtubule organization
GO:0031397 P negative regulation of protein ubiquitination
GO:0031953 P negative regulation of protein autophosphorylation
GO:0032088 P negative regulation of NF-kappaB transcription factor activity
GO:0032417 P positive regulation of sodium:proton antiporter activity
GO:0042308 P negative regulation of protein import into nucleus
GO:0046872 F metal ion binding
GO:0048306 F calcium-dependent protein binding
GO:0050821 P protein stabilization
GO:0051222 P positive regulation of protein transport
GO:0051259 P protein complex oligomerization
GO:0051453 P regulation of intracellular pH
GO:0060050 P positive regulation of protein glycosylation
GO:0061024 P membrane organization
GO:0061025 P membrane fusion
GO:0070062 C extracellular exosome
GO:0070885 P negative regulation of calcineurin-NFAT signaling cascade
GO:0071468 P cellular response to acidic pH
GO:0090314 P positive regulation of protein targeting to membrane
GO:1901214 P regulation of neuron death
RNA-seq EntryA_BomaMG_comp25643_c6_seq6
Sequence
(Amino Acid)
MGNKSSLLLREEEIAQIQEETGFTPNQIERLYSRFTSLDKNDCGTLSREDFLRIPELAIN
PLSERIVQSFFAESHDDRVNFLQFMRVLAHFRPIKKNRENKLNCREEKLRFAFSMYDLDS
DGKISRDELLAILHMMVGANISEEQLTSIAERTIIEADTNNDQMISFEEFCRALERTDVE
QKMSIRFLN
*(62 a.a.)

- SilkBase 1999-2023 -