SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG18994_3prime_partial:A_BomaMG_comp25643_c1_seq17
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000922 C spindle pole
GO:0004843 F thiol-dependent deubiquitinase
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006508 P proteolysis
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0010212 P response to ionizing radiation
GO:0016568 P chromatin organization
GO:0016787 F hydrolase activity
GO:0031572 P mitotic G2 DNA damage checkpoint signaling
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0045739 P positive regulation of DNA repair
GO:0046872 F metal ion binding
GO:0051301 P cell division
GO:0070531 C BRCA1-A complex
GO:0070536 P protein K63-linked deubiquitination
GO:0070537 P histone H2A K63-linked deubiquitination
GO:0070552 C BRISC complex
RNA-seq EntryA_BomaMG_comp25643_c1_seq17
Sequence
(Amino Acid)
MLQKVRLSSDVALVCMQHALSTEKEEIMGLLIGEVHDNGALVSIVSSVILRRLDKKPDRV
EISEEQLVQATVRAEELAAEVGKPLRVVGWYHSHPHITVWPSHVDLATQSMYQRMDASFV
GIIFAVFLTDQSTKAPSVSLFNKKHGMFLIFIKNVIFSVLV
(52 a.a.)

- SilkBase 1999-2023 -