SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG18801_3prime_partial:A_BomaMG_comp25623_c0_seq4
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000902 P cell morphogenesis
GO:0001708 P cell fate specification
GO:0001737 P establishment of imaginal disc-derived wing hair orientation
GO:0001738 P morphogenesis of a polarized epithelium
GO:0005179 F hormone activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005918 C septate junction
GO:0005923 C bicellular tight junction
GO:0006963 P positive regulation of antibacterial peptide biosynthetic process
GO:0007275 P multicellular organism development
GO:0007280 P pole cell migration
GO:0007318 P pole plasm protein localization
GO:0007391 P dorsal closure
GO:0007399 P nervous system development
GO:0007464 P R3/R4 cell fate commitment
GO:0007472 P wing disc morphogenesis
GO:0007608 P sensory perception of smell
GO:0008105 P protein localization
GO:0008283 P cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0008406 P gonad development
GO:0008593 P regulation of Notch signaling pathway
GO:0016020 C membrane
GO:0016323 C basolateral plasma membrane
GO:0016327 C apicolateral plasma membrane
GO:0016328 C lateral plasma membrane
GO:0016331 P morphogenesis of embryonic epithelium
GO:0016332 P establishment or maintenance of polarity of embryonic epithelium
GO:0016333 P morphogenesis of follicular epithelium
GO:0016334 P establishment or maintenance of polarity of follicular epithelium
GO:0016335 P morphogenesis of larval imaginal disc epithelium
GO:0016336 P establishment or maintenance of polarity of larval imaginal disc epithelium
GO:0019991 P septate junction assembly
GO:0030054 C cell junction
GO:0030100 P regulation of endocytosis
GO:0030154 P cell differentiation
GO:0030707 P ovarian follicle cell development
GO:0030714 P anterior/posterior axis specification, follicular epithelium
GO:0031594 C neuromuscular junction
GO:0035088 P establishment or maintenance of apical/basal cell polarity
GO:0042048 P olfactory behavior
GO:0042058 P regulation of epidermal growth factor receptor signaling pathway
GO:0042067 P establishment of ommatidial planar polarity
GO:0045169 C fusome
GO:0045186 P zonula adherens assembly
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045198 P establishment of epithelial cell apical/basal polarity
GO:0045571 P negative regulation of imaginal disc growth
GO:0045823 P positive regulation of heart contraction
GO:0046425 P regulation of receptor signaling pathway via JAK-STAT
GO:0048749 P compound eye development
GO:0048863 P stem cell differentiation
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0050803 P regulation of synapse structure or activity
GO:0050896 P response to stimulus
GO:0051726 P regulation of cell cycle
GO:0060581 P cell fate commitment involved in pattern specification
GO:0072002 P Malpighian tubule development
GO:0072089 P stem cell proliferation
RNA-seq EntryA_BomaMG_comp25623_c0_seq4
Sequence
(Amino Acid)
MFRCIPLFKCNRQVESVDKRHCSLPTVPEDILRYSRSLEELLLDANHIRDLPKNFFRLHR
LRRLGLSDNEIHKLPADIQNFENLVELDVSRNDIPDIPEDIKKLRALQIADFSSNPIPRL
PAGFSQLRALTVLGLNDMSLTSLPNDFGSLVSLQSLELRENLLKSLPESLKNLTNLQRLD
LGDNEIEELPGFIGELPALEELWLDHNKLQYLPPEIGNLKALICLDVSENKLEKIPEEIG
GLSSLTDLHLSQNMLESIPDGIGHLYKLTILKLDQNRLHTLNENVGRCTNLQELILTENF
LTELPDSIGNLNKLTVLNVDRNSLAEIPMDIGNMTLLGVLSLRDNKLTKLPNELGNCTSL
HVLDVSGNRLQYLPYTLVNLELKAVWLSENQAQPLLTFQTDRDESTGENVLTCFLLPQLS
YTQQPDTSVSRDRDSDNEDWEEKEASRTHSVKFTEDVSDVRETPFVRQNTPHPKDLKAKA
HKLLAGRSPDNAITQPAKTESPTTNGLPLSPIKIVPVVEEKVEDEVQKIEEIPEIIKDDD
SDTITAVDRDSSETENDENEDSDELEAIKKQELNDERKPDDEATEDIPDGESVSERAESE
ARLVGEQRCIEVRINRTAGGLGLSIAGGRGSTPYIGNDEGIFISRVTNNGPAYLAGLRVG
DKVLSVNGTSVVDVDHYYAVEVLKASGPTLTLVVTRDSPNSTRTHSRAPSGASHHSVSST
TDTVSTLENGQVPTNRSLQTKSLIIGNQYAQEYEQEFKEQVLNQSTPIIATPVASHSPSP
PQMRTETYQRLQASPPPATTPYIPPVYQQKVLVHTTLIRDGAGLGFSIAGGKGSPPYRED
SDAIYISRISPQGAAAKDGKMQVGDKVISINGVDMEKAAHETAVSLLTGHERFVRLVLQR
TITTEQGDQPQRKSTTDEVR
(305 a.a.)

- SilkBase 1999-2023 -