SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG18774_internal:A_BomaMG_comp25619_c6_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003674 F molecular_function
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008150 P biological_process
GO:0010956 P negative regulation of calcidiol 1-monooxygenase activity
GO:0010977 P negative regulation of neuron projection development
GO:0016363 C nuclear matrix
GO:0016604 C nuclear body
GO:0017053 C transcription repressor complex
GO:0030097 P hemopoiesis
GO:0030099 P myeloid cell differentiation
GO:0034121 P regulation of toll-like receptor signaling pathway
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0050767 P regulation of neurogenesis
GO:0051569 P regulation of histone H3-K4 methylation
GO:0070105 P positive regulation of interleukin-6-mediated signaling pathway
GO:0071222 P cellular response to lipopolysaccharide
RNA-seq EntryA_BomaMG_comp25619_c6_seq2
Sequence
(Amino Acid)
KFGINRLVGDRTDEEEEELHNNETRAEGTSPASRCGSPCWAPSPQSPRSVRSSSPELEVD
SPPSSPRRQPDSSPPPKRSEAFSVSALLRPDAPRVQPQRPFLYPPLPFAEFLRDAGGLGL
HGWGGYSNLYLHAVQAAGPELLRLRAAVLGAPGPLTRPLPIGDVYSCVKCEKMFSTPHGL
EVHARRSHNGKRPFACEQCSKTFGHEISLSQHRALHSVAKLFECKQCGKTFKRSSTLSTH
LLIHSDTRPYPCQ
(83 a.a.)

- SilkBase 1999-2023 -