SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG18754_complete:A_BomaMG_comp25618_c1_seq4
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0001891 C phagocytic cup
GO:0001934 P positive regulation of protein phosphorylation
GO:0002093 P auditory receptor cell morphogenesis
GO:0002551 P mast cell chemotaxis
GO:0003382 P epithelial cell morphogenesis
GO:0003924 F GTPase activity
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0005884 C actin filament
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006897 P endocytosis
GO:0006911 P phagocytosis, engulfment
GO:0006935 P chemotaxis
GO:0006972 P hyperosmotic response
GO:0007010 P cytoskeleton organization
GO:0007015 P actin filament organization
GO:0007155 P cell adhesion
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007264 P small GTPase mediated signal transduction
GO:0007411 P axon guidance
GO:0008152 P metabolic process
GO:0008283 P cell population proliferation
GO:0008361 P regulation of cell size
GO:0010592 P positive regulation of lamellipodium assembly
GO:0010762 P regulation of fibroblast migration
GO:0010811 P positive regulation of cell-substrate adhesion
GO:0014041 P regulation of neuron maturation
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0016358 P dendrite development
GO:0016477 P cell migration
GO:0016601 P Rac protein signal transduction
GO:0017137 F small GTPase binding
GO:0019897 C extrinsic component of plasma membrane
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0021799 P cerebral cortex radially oriented cell migration
GO:0021831 P embryonic olfactory bulb interneuron precursor migration
GO:0021894 P cerebral cortex GABAergic interneuron development
GO:0022604 P regulation of cell morphogenesis
GO:0030027 C lamellipodium
GO:0030032 P lamellipodium assembly
GO:0030036 P actin cytoskeleton organization
GO:0030041 P actin filament polymerization
GO:0030334 P regulation of cell migration
GO:0030742 F GTP-dependent protein binding
GO:0030838 P positive regulation of actin filament polymerization
GO:0031410 C cytoplasmic vesicle
GO:0031529 P ruffle organization
GO:0031901 C early endosome membrane
GO:0031996 F thioesterase binding
GO:0032587 C ruffle membrane
GO:0032707 P negative regulation of interleukin-23 production
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0035567 P non-canonical Wnt signaling pathway
GO:0036464 C cytoplasmic ribonucleoprotein granule
GO:0042470 C melanosome
GO:0042826 F histone deacetylase binding
GO:0042995 C cell projection
GO:0043552 P positive regulation of phosphatidylinositol 3-kinase activity
GO:0043652 P engulfment of apoptotic cell
GO:0045216 P cell-cell junction organization
GO:0045453 P bone resorption
GO:0045740 P positive regulation of DNA replication
GO:0048532 P anatomical structure arrangement
GO:0048812 P neuron projection morphogenesis
GO:0048813 P dendrite morphogenesis
GO:0048870 P cell motility
GO:0048873 P homeostasis of number of cells within a tissue
GO:0051022 F Rho GDP-dissociation inhibitor binding
GO:0051496 P positive regulation of stress fiber assembly
GO:0051668 P localization within membrane
GO:0051894 P positive regulation of focal adhesion assembly
GO:0051932 P synaptic transmission, GABAergic
GO:0060071 P Wnt signaling pathway, planar cell polarity pathway
GO:0060263 P regulation of respiratory burst
GO:0070062 C extracellular exosome
GO:0071260 P cellular response to mechanical stimulus
GO:0071526 P semaphorin-plexin signaling pathway
GO:0071542 P dopaminergic neuron differentiation
GO:0072659 P protein localization to plasma membrane
GO:0090023 P positive regulation of neutrophil chemotaxis
GO:0090103 P cochlea morphogenesis
GO:0097178 P ruffle assembly
GO:1900026 P positive regulation of substrate adhesion-dependent cell spreading
RNA-seq EntryA_BomaMG_comp25618_c1_seq4
Sequence
(Amino Acid)
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR
EDKDTIEKLKDKKLAPITYTQGLGMSKEINAVKYLECSALTQKGLKTVFDEAIRAVLCPV
QPIKGRRRHCSLF
*(63 a.a.)

- SilkBase 1999-2023 -