SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG18532_internal:A_BomaMG_comp25574_c2_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000159 C protein phosphatase type 2A complex
GO:0000184 P nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000188 P obsolete inactivation of MAPK activity
GO:0000775 C chromosome, centromeric region
GO:0003823 F antigen binding
GO:0004722 F protein serine/threonine phosphatase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0006275 P regulation of DNA replication
GO:0006355 P regulation of transcription, DNA-templated
GO:0006461 P protein-containing complex assembly
GO:0006470 P protein dephosphorylation
GO:0006672 P ceramide metabolic process
GO:0006915 P apoptotic process
GO:0007059 P chromosome segregation
GO:0007084 P mitotic nuclear membrane reassembly
GO:0007143 P female meiotic nuclear division
GO:0008380 P RNA splicing
GO:0008601 F protein phosphatase regulator activity
GO:0010033 P response to organic substance
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0019932 P second-messenger-mediated signaling
GO:0030111 P regulation of Wnt signaling pathway
GO:0030155 P regulation of cell adhesion
GO:0030308 P negative regulation of cell growth
GO:0034047 P regulation of phosphoprotein phosphatase activity
GO:0040008 P regulation of growth
GO:0042518 P negative regulation of tyrosine phosphorylation of STAT protein
GO:0045595 P regulation of cell differentiation
GO:0046982 F protein heterodimerization activity
GO:0051232 P meiotic spindle elongation
GO:0051306 P mitotic sister chromatid separation
GO:0051754 P meiotic sister chromatid cohesion, centromeric
GO:0070062 C extracellular exosome
GO:0070262 P peptidyl-serine dephosphorylation
GO:1903538 P regulation of meiotic cell cycle process involved in oocyte maturation
GO:2001241 P positive regulation of extrinsic apoptotic signaling pathway in absence of ligand
RNA-seq EntryA_BomaMG_comp25574_c2_seq1
Sequence
(Amino Acid)
SLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGVERTKSELIPFLTETIYDEDEVLLA
LAEQLGNFINLVGGGEFAHCLLPPLETLAAVEETVVRDKAVASLRAVAEHHSPQALEEHF
VPLVQRLAGGDWFTSRTSACGLFSVCYPRVSAVVKAELRQHFCSLCQDDTPMVRRAAAYK
LGEFAKVVEIEYVKSDLIPIFVFLAKDDQDSVRLLAAEACAVVASLLAPEDMEQHVMPTV
RARAGDTSWRVRYMVADKFVELQQA
(87 a.a.)

- SilkBase 1999-2023 -