| Name | O_BomaMG17939_complete:A_BomaMG_comp25528_c0_seq2 |
| Scaffold_id | |
NCBI non-redundant
(nr) | |
| Ontology |
| GO:0003674 |
F |
molecular_function |
| GO:0005737 |
C |
cytoplasm |
| GO:0005739 |
C |
mitochondrion |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0005789 |
C |
endoplasmic reticulum membrane |
| GO:0009055 |
F |
electron transfer activity |
| GO:0016020 |
C |
membrane |
| GO:0016021 |
C |
integral component of membrane |
| GO:0019899 |
F |
enzyme binding |
| GO:0020037 |
F |
heme binding |
| GO:0031090 |
C |
organelle membrane |
| GO:0043231 |
C |
intracellular membrane-bounded organelle |
| GO:0046686 |
P |
response to cadmium ion |
| GO:0046872 |
F |
metal ion binding |
| GO:0055114 |
P |
obsolete oxidation-reduction process |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomaMG_comp25528_c0_seq2 |
Sequence
(Amino Acid) | MSKNLTLDEVKKHKDEKSVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGKDGTQAFEDVG
HSDDARELLKKYKIGTLPPGERCKIITDCSKLKWAVVALAGALLIGIVLKKYLN
*(37 a.a.) |
