SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG1789_5prime_partial:A_BomaMG_comp12851_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		mRNA_cap-binding_protein_eIF4E_[Bombyx_mori]
Ontology
GO:0000022 P mitotic spindle elongation
GO:0000339 F RNA cap binding
GO:0000340 F RNA 7-methylguanosine cap binding
GO:0000932 C P-body
GO:0001558 P regulation of cell growth
GO:0002191 P cap-dependent translational initiation
GO:0003723 F RNA binding
GO:0003743 F translation initiation factor activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005845 C mRNA cap binding complex
GO:0005875 C microtubule associated complex
GO:0006325 P chromatin organization
GO:0006412 P translation
GO:0006413 P translational initiation
GO:0006417 P regulation of translation
GO:0007052 P mitotic spindle organization
GO:0007060 P male meiosis chromosome segregation
GO:0007067 P mitotic cell cycle
GO:0007076 P mitotic chromosome condensation
GO:0007112 P male meiosis cytokinesis
GO:0010032 P meiotic chromosome condensation
GO:0016070 P RNA metabolic process
GO:0016281 C eukaryotic translation initiation factor 4F complex
GO:0016321 P female meiosis chromosome segregation
GO:0022008 P neurogenesis
GO:0030307 P positive regulation of cell growth
GO:0031370 F eukaryotic initiation factor 4G binding
GO:0031594 C neuromuscular junction
GO:0035071 P salivary gland cell autophagic cell death
GO:0045995 P regulation of embryonic development
GO:0048102 P autophagic cell death
GO:0048136 P male germ-line cyst formation
GO:0048137 P spermatocyte division
GO:0048515 P spermatid differentiation
GO:0097482 C muscle cell postsynaptic specialization
RNA-seq EntryA_BomaMG_comp12851_c0_seq1
Sequence
(Amino Acid)
VDSVAPFCRKFASLSSQDMAGNTTEEVEGSTTTETKTNSNAEVPPEFLIKHPLQNQWSLW
FYDNDRNKTWEENLIELTTFDTVEDFWRLYHHIKLPSELRQGHDYAVFKQGIRPMWEDDA
NKMGGRWLISLEKKQRFTDLDRFWLDVVLLLIGENFENSDEICGAVVNVRPKVDKIAIWT
ADAMKQHATIEIGKKLKEQLGIHGKIGFQVHRDTMVKHSSATKNLYTV
*(75 a.a.)

- SilkBase 1999-2023 -