SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG17816_5prime_partial:A_BomaMG_comp25506_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0008134 F transcription factor binding
GO:0008284 P positive regulation of cell population proliferation
GO:0009653 P anatomical structure morphogenesis
GO:0010255 P glucose mediated signaling pathway
GO:0033137 P negative regulation of peptidyl-serine phosphorylation
GO:0035538 F carbohydrate response element binding
GO:0035556 P intracellular signal transduction
GO:0042593 P glucose homeostasis
GO:0042803 F protein homodimerization activity
GO:0045723 P positive regulation of fatty acid biosynthetic process
GO:0045821 P positive regulation of glycolytic process
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046889 P positive regulation of lipid biosynthetic process
GO:0046982 F protein heterodimerization activity
GO:0046983 F protein dimerization activity
GO:0055089 P fatty acid homeostasis
GO:0070328 P triglyceride homeostasis
GO:0071157 P regulation of cell cycle
GO:0071322 P cellular response to carbohydrate stimulus
GO:0090324 P negative regulation of oxidative phosphorylation
GO:2000505 P energy homeostasis
RNA-seq EntryA_BomaMG_comp25506_c1_seq1
Sequence
(Amino Acid)
AGSGWPRAGRLREMFARHVANRTLHNWKYWLFSVVSAALVESFSACVSCGSGSDLVRTTL
LWAEQHCSLVEMRPAVLNSLRVLCTTTDILTNPERLPDEARAAVAAGAAVKTEPS
*(37 a.a.)

- SilkBase 1999-2023 -