SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG17653_complete:A_BomaMG_comp25483_c4_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0005215 F transporter activity
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006814 P sodium ion transport
GO:0007005 P mitochondrion organization
GO:0007512 P adult heart development
GO:0007626 P locomotory behavior
GO:0009437 P carnitine metabolic process
GO:0015226 F carnitine transmembrane transporter activity
GO:0015293 F symporter activity
GO:0015491 F cation:cation antiporter activity
GO:0015651 F quaternary ammonium group transmembrane transporter activity
GO:0015697 P quaternary ammonium group transport
GO:0015879 P carnitine transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0022857 F transmembrane transporter activity
GO:0030165 F PDZ domain binding
GO:0031526 C brush border membrane
GO:0048608 P reproductive structure development
GO:0052106 P obsolete quorum sensing involved in interaction with host
GO:0055085 P transmembrane transport
GO:0060731 P positive regulation of intestinal epithelial structure maintenance
GO:0070062 C extracellular exosome
GO:0070715 P sodium-dependent organic cation transport
GO:1902603 P carnitine transmembrane transport
RNA-seq EntryA_BomaMG_comp25483_c4_seq2
Sequence
(Amino Acid)
MGLIAWAIPDWRSLTLALYIPQLITVGYFWIIPESIRWYMSKGRYEESENVLQEVAKVNG
KHLSKKSLEALRSTAEEVMRRKEIENIEKAKEPWLLVLVLHNRRILIRCLVSPVWWITTT
LIYYGLSINAVNMSGNPYLNYMAVAAAEIPGFWIAVLLMGRVGRRPVLIAAFWLCGVCQV
AYIFMPNNLYAVSLAVYLVGKISISTVVTAIYMYTAELYPTKYRHNLFAFSSMVGRIGSI
IAPLTPAIGAATFDNLPFILFASMAFLSGFLMFLTPETNGTKLPDTMEEASNIGLRDK
*(98 a.a.)

- SilkBase 1999-2023 -