SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG17642_5prime_partial:A_BomaMG_comp25478_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000723 P telomere maintenance
GO:0000783 C nuclear telomere cap complex
GO:0000784 C chromosome, telomeric region
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003691 F double-stranded telomeric DNA binding
GO:0004003 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006310 P DNA recombination
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0008022 F protein C-terminus binding
GO:0008283 P cell population proliferation
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0016817 F hydrolase activity, acting on acid anhydrides
GO:0031625 F ubiquitin protein ligase binding
GO:0032481 P positive regulation of type I interferon production
GO:0032508 P DNA duplex unwinding
GO:0042162 F telomeric DNA binding
GO:0043564 C Ku70:Ku80 complex
GO:0044212 F transcription cis-regulatory region binding
GO:0044822 F RNA binding
GO:0044877 F protein-containing complex binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0048660 P regulation of smooth muscle cell proliferation
GO:0050769 P positive regulation of neurogenesis
GO:0051575 F 5'-deoxyribose-5-phosphate lyase activity
GO:0060218 P hematopoietic stem cell differentiation
GO:0070419 C nonhomologous end joining complex
GO:0071480 P cellular response to gamma radiation
GO:0071481 P cellular response to X-ray
GO:0075713 P establishment of integrated proviral latency
GO:1904430 P negative regulation of t-circle formation
RNA-seq EntryA_BomaMG_comp25478_c0_seq1
Sequence
(Amino Acid)
FGSAMSFLLFHQRKSVNSVAWNSDLSIGPDLKIPISSYIKIDDKPVVGKWTKKVKDPVTS
KPSKEEAIKKERIFYNAENHSKVKSDSRTKGYQYGQQIIPFTQNEETELYASGEKGLTVY
GFTHKENIQWQCLTDVGLSYVFGRKGDVKAQQAVKCLVECLLELNLVGVARRVCISNYAP
KMYALIPNVDNENGICLSMIQLCYKENIKHMVFPPTNLKKYSCTDAQVNAFKELIEAMDL
TKAYDDTYDDTEAFPIGETVSPTAQYILDCIAFRSLNPAAPLPPPRDEIMTLFKVPPLVE
MRSRGALEKIEKLFPLNKIEPRPKKNKQQQESPQTLTVLPVTKKAENEPFEIPKISLFMD
KNSTETTSIGTMNPIDDYKALTNKGKSLSNLATEMTESIQSLLYYNLHDDSKKAVNAMKF
FRNECIKSDPSIYNNWLQKLKMSLNHEKNTKVLEVINENELNVILKSESSLSTYENEDSQ
IYENDTIPNTLPVVIDPEVDALFDEM
*(168 a.a.)

- SilkBase 1999-2023 -