SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG17612_complete:A_BomaMG_comp25471_c6_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003714 F transcription corepressor activity
GO:0005102 F signaling receptor binding
GO:0005622 C intracellular anatomical structure
GO:0005730 C nucleolus
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0006461 P protein-containing complex assembly
GO:0006810 P transport
GO:0007031 P peroxisome organization
GO:0008017 F microtubule binding
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016558 P protein import into peroxisome matrix
GO:0016560 P protein import into peroxisome matrix, docking
GO:0016561 P protein import into peroxisome matrix, translocation
GO:0032091 P negative regulation of protein binding
GO:0034453 P microtubule anchoring
GO:0036250 P peroxisome transport along microtubule
GO:0042802 F identical protein binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0044721 P protein import into peroxisome matrix, substrate release
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0047485 F protein N-terminus binding
GO:0048487 F beta-tubulin binding
GO:0051260 P protein homooligomerization
GO:1901094 P negative regulation of protein homotetramerization
RNA-seq EntryA_BomaMG_comp25471_c6_seq3
Sequence
(Amino Acid)
MSTETLIAAGDGVRENLVTTAVNFLTNPNVQRCTIESKERFLRSKGLTDTEIQKALEKCM
NLVEFPSMSSELMFFHQSRSSWFRDHVLPFLMYGSLAYGCYWFYKNCVRHLIFVDQPKRK
TTNECLEEVRKSLEDLNTNVFALKGELNSLQQNTFRCSLDTIKGDIASVKGILLNRNQFP
SLKSRTDPPSIPAWQRQSEEATSTEAPGEDKKKTHRARSQRSESGGSNSSEGEQATKNSD
SSLEIIQ
*(81 a.a.)

- SilkBase 1999-2023 -