SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG17262_complete:A_BomaMG_comp25424_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001649 P osteoblast differentiation
GO:0001942 P hair follicle development
GO:0002376 P immune system process
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0007623 P circadian rhythm
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016055 P Wnt signaling pathway
GO:0030154 P cell differentiation
GO:0030282 P bone mineralization
GO:0030539 P male genitalia development
GO:0032922 P circadian regulation of gene expression
GO:0034122 P negative regulation of toll-like receptor signaling pathway
GO:0035239 P tube morphogenesis
GO:0036335 P intestinal stem cell homeostasis
GO:0045087 P innate immune response
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046849 P bone remodeling
GO:0048511 P rhythmic process
GO:0048565 P digestive tract development
GO:0050673 P epithelial cell proliferation
GO:0050710 P negative regulation of cytokine production
GO:0061290 P canonical Wnt signaling pathway involved in metanephric kidney development
GO:0072202 P cell differentiation involved in metanephros development
GO:0072224 P metanephric glomerulus development
GO:0072282 P metanephric nephron tubule morphogenesis
GO:0090190 P positive regulation of branching involved in ureteric bud morphogenesis
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:2001013 P epithelial cell proliferation involved in renal tubule morphogenesis
RNA-seq EntryA_BomaMG_comp25424_c0_seq2
Sequence
(Amino Acid)
MDFGVFRTRLLLWLLPGMVTGGLVRRTTDEQEEMPCSTYTLDGLIYLDCNERGLSELPEG
LNYESQVLILTNNNFATFPSQLESFSRVQVLDLSGNHLNVPLPSYIENWTSLNTLNLSNN
NYESWLNDGRQYKFRRLDLSRNKIKNIEEDSFSGMTNLYFLDLSENRINEFSPKLLTAAK
SLNTLRLSRNYLSELPKFQSNSLRSLHLSYCLITNLQVDSLSEMTSLLEIDLSSNQIESI
PDNVSSNTLQELDLSYNEIGSLTDRTFSSLPHLAVLNLRGNEFREVWSTSHFASNPFLRE
VHVKGNRWNCEGFSVNLLLTYEFLTKEPSKIHDRASLICYTPSNVTQLSWQQAYIQTWHP
NASTVESYTTLAAMVGIIIGIVLTSLICRGIIAINKPDPPSPETETTIVNLNGTPQSRAE
SVVMRVPLRDEDLPPTYDEALLMPRLNSSFHSLPDFVDDEPSQRSRRSRSIGDLTEHRPR
VNDRRSVRRTVEIHIT
*(164 a.a.)

- SilkBase 1999-2023 -