SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG17158_complete:A_BomaMG_comp25415_c5_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000151 C ubiquitin ligase complex
GO:0000209 P protein polyubiquitination
GO:0001664 F G protein-coupled receptor binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006281 P DNA repair
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006515 P protein quality control for misfolded or incompletely synthesized proteins
GO:0006974 P cellular response to DNA damage stimulus
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0019899 F enzyme binding
GO:0019900 F kinase binding
GO:0030018 C Z disc
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030544 F Hsp70 protein binding
GO:0030579 P ubiquitin-dependent SMAD protein catabolic process
GO:0030674 F protein-macromolecule adaptor activity
GO:0030911 F TPR domain binding
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0031371 C ubiquitin conjugating enzyme complex
GO:0031398 P positive regulation of protein ubiquitination
GO:0031625 F ubiquitin protein ligase binding
GO:0031647 P regulation of protein stability
GO:0031943 P regulation of glucocorticoid metabolic process
GO:0032091 P negative regulation of protein binding
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0034450 F ubiquitin-ubiquitin ligase activity
GO:0036503 P ERAD pathway
GO:0038128 P ERBB2 signaling pathway
GO:0042405 C nuclear inclusion body
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0042803 F protein homodimerization activity
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045111 C intermediate filament cytoskeleton
GO:0046332 F SMAD binding
GO:0051443 P positive regulation of ubiquitin-protein transferase activity
GO:0051604 P protein maturation
GO:0051787 F misfolded protein binding
GO:0051865 P protein autoubiquitination
GO:0051879 F Hsp90 protein binding
GO:0061630 F ubiquitin protein ligase activity
GO:0070062 C extracellular exosome
GO:0070534 P protein K63-linked ubiquitination
GO:0071218 P cellular response to misfolded protein
GO:0090035 P positive regulation of chaperone-mediated protein complex assembly
GO:1904264 F ubiquitin protein ligase activity
RNA-seq EntryA_BomaMG_comp25415_c5_seq3
Sequence
(Amino Acid)
MSKHMYSTANLTDKELKEQGNRLFSLRRYEDAKNCYTKAIIKNPSVATYFTNRALCHLKM
KHWEATCQDCRRALDIDTNQVKGHFFLGQALVELECYDEAIKHLHRANDLAREQKLNFGD
DIAAQLRTARKKRWNVQEEKRITQEIELQTYLNRLINEDMQRRIETLKLDGNNEDDRNTK
ISKIEEECNNYSSELNNLFSKIDDRRRKRDVPDYLCGKISFEILNEPVITPSGITYEKKD
IEEHLERVGHFDPVTRVKLTADQLIPNFTMKEVVDAFLQDNEWALDY
*(95 a.a.)

- SilkBase 1999-2023 -