SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG168_3prime_partial:A_BomaMG_comp1894_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_regulator_of_telomere_elongation_helicase_1_homolog_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0000723 P telomere maintenance
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0004003 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006139 P nucleobase-containing compound metabolic process
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0008026 F helicase activity
GO:0010569 P regulation of double-strand break repair via homologous recombination
GO:0016787 F hydrolase activity
GO:0016818 F hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0032508 P DNA duplex unwinding
GO:0046872 F metal ion binding
GO:0051536 F iron-sulfur cluster binding
GO:0051539 F 4 iron, 4 sulfur cluster binding
RNA-seq EntryA_BomaMG_comp1894_c0_seq1
Sequence
(Amino Acid)
MPYNYLLDPKSRKANGVELMNNIVILDEAHNVEKMCEESASLQIRTTDIALCIDEITHVM
KSFSETSEEQIDATVDSSQPKDFTCDDLCILKEMMLAFEKAVDDIEVG
(35 a.a.)

- SilkBase 1999-2023 -