SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG16898_complete:A_BomaMG_comp25387_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006895 P Golgi to endosome transport
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0008152 P metabolic process
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0009790 P embryo development
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0019003 F GDP binding
GO:0031410 C cytoplasmic vesicle
GO:0031901 C early endosome membrane
GO:0032456 P endocytic recycling
GO:0032880 P regulation of protein localization
GO:0042742 P defense response to bacterium
GO:0045335 C phagocytic vesicle
GO:0055037 C recycling endosome
GO:0090382 P phagosome maturation
RNA-seq EntryA_BomaMG_comp25387_c0_seq1
Sequence
(Amino Acid)
MTSGPYNYSYIFKYIIIGDMGVGKSCLLHQFTDKKFMADCPHTIGVEFGTRIIEVAGQKI
KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIF
LIGNKSDLDAQRDVTYEEAKQFADENGLMFVEASAKTGQNVEEAFLETAKKIYQSIQDGR
LDLNAAESGVQHKPASPGRPLAAPPSSRDNCAC
*(70 a.a.)

- SilkBase 1999-2023 -