SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG16741_5prime_partial:A_BomaMG_comp25367_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000187 P obsolete activation of MAPK activity
GO:0000793 C condensed chromosome
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004708 F MAP kinase kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005635 C nuclear envelope
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007362 P terminal region determination
GO:0008595 P anterior/posterior axis specification, embryo
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0033314 P mitotic DNA replication checkpoint signaling
GO:0040018 P positive regulation of multicellular organism growth
GO:0042386 P hemocyte differentiation
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071481 P cellular response to X-ray
RNA-seq EntryA_BomaMG_comp25367_c1_seq1
Sequence
(Amino Acid)
AVLKGLSYLRDKHAIMHRDVKPSNILVNSNGEIKICDFGVSGQLIDSMANSFVGTRSYMS
PERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPDAKTLAAIFGGQNEDHSPGQAPNSP
RPMAIFELLDYIVNEPPPKLPSGIFSDEFKDFVDRCLKKNPDERADLKTLMNHEWIRKAE
AEKVDIAGWVCKTMDLMPSTPNSNVSPFSS
*(69 a.a.)

- SilkBase 1999-2023 -