SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG15815_3prime_partial:A_BomaMG_comp25154_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0002376 P immune system process
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003723 F RNA binding
GO:0003924 F GTPase activity
GO:0004003 F DNA helicase activity
GO:0004004 F RNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005852 C eukaryotic translation initiation factor 3 complex
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006417 P regulation of translation
GO:0006915 P apoptotic process
GO:0007059 P chromosome segregation
GO:0008134 F transcription factor binding
GO:0008143 F poly(A) binding
GO:0008190 F eukaryotic initiation factor 4E binding
GO:0008625 P extrinsic apoptotic signaling pathway via death domain receptors
GO:0009615 P response to virus
GO:0010494 C cytoplasmic stress granule
GO:0010501 P RNA secondary structure unwinding
GO:0010628 P positive regulation of gene expression
GO:0016020 C membrane
GO:0016032 P viral process
GO:0016055 P Wnt signaling pathway
GO:0016607 C nuclear speck
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0017111 F nucleoside-triphosphatase activity
GO:0017148 P negative regulation of translation
GO:0022627 C cytosolic small ribosomal subunit
GO:0030307 P positive regulation of cell growth
GO:0030308 P negative regulation of cell growth
GO:0031333 P negative regulation of protein-containing complex assembly
GO:0031369 F translation initiation factor binding
GO:0032508 P DNA duplex unwinding
GO:0032728 P positive regulation of interferon-beta production
GO:0034063 P stress granule assembly
GO:0035556 P intracellular signal transduction
GO:0035613 F RNA stem-loop binding
GO:0042254 P ribosome biogenesis
GO:0042256 P mature ribosome assembly
GO:0043024 F ribosomal small subunit binding
GO:0043065 P positive regulation of apoptotic process
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043273 F CTPase activity
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0044822 F RNA binding
GO:0045070 P positive regulation of viral genome replication
GO:0045087 P innate immune response
GO:0045727 P positive regulation of translation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0045948 P positive regulation of translational initiation
GO:0048027 F mRNA 5'-UTR binding
GO:0070062 C extracellular exosome
GO:0071243 P cellular response to arsenic-containing substance
GO:0071470 P cellular response to osmotic stress
GO:0071651 P positive regulation of chemokine (C-C motif) ligand 5 production
GO:0097193 P intrinsic apoptotic signaling pathway
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
GO:1903608 P protein localization to cytoplasmic stress granule
GO:2001243 P negative regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomaMG_comp25154_c0_seq2
Sequence
(Amino Acid)
MSNVTNQNGTGLEQQLAGLDLQPQAPKSTGRYIPPHLRRQLQATSDQGRDSGSQNGEPER
WNESEKWNDRERERDRRGPRDVRREEDYEPPAPRNDRWKEPEPRAEERSNSRWPSDDVRR
TRSRKDENDWTVPLPRDERQELLLFGTGNTGINFSKYEDIPVEASGDRVPDCITSFEDVN
LTELMRTNISLARYDKPTPVQKYAIPIILSRRDVMACAQTGSGKTAAFLVPILNQMYEAG
PVKHMGPYNKRKQYPLGLVLAPTRELATQIFDEARKFAYRSRVRPCVVYGGSPINDQFRE
LESGCHLLVATPGRLVDMLARGRVALDHCRHLVLDEADRMLDMGFEPQIRKIVECHTMPK
TGERQTLMFSATFPKQIQLLAQDFLYNYVFLAVGRVGSTSENITQKVVWVDEMDKRSFLL
DLLNASNLLQRARPEEDQLILVFVETKKGADQLEEYLYSQGYPVTSIHGDRNQREREDAL
RRFRTGQTPILVATAVAARGLDIPHVRHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSF
FNDTNRGLARDLVELLVEAKQDVPNWLTSTAADGRL
(191 a.a.)

- SilkBase 1999-2023 -