SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG15092_complete:A_BomaMG_comp24977_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0002011 P morphogenesis of an epithelial sheet
GO:0002162 F dystroglycan binding
GO:0003779 F actin binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005604 C basement membrane
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005913 C adherens junction
GO:0005925 C focal adhesion
GO:0006509 P membrane protein ectodomain proteolysis
GO:0006607 P NLS-bearing protein import into nucleus
GO:0007016 P obsolete cytoskeletal anchoring at plasma membrane
GO:0008307 F structural constituent of muscle
GO:0009279 C cell outer membrane
GO:0010470 P regulation of gastrulation
GO:0010717 P regulation of epithelial to mesenchymal transition
GO:0014044 P Schwann cell development
GO:0015631 F tubulin binding
GO:0016010 C dystrophin-associated glycoprotein complex
GO:0016011 C dystroglycan complex
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016032 P viral process
GO:0016323 C basolateral plasma membrane
GO:0016340 P calcium-dependent cell-matrix adhesion
GO:0017166 F vinculin binding
GO:0019048 P modulation by virus of host process
GO:0021682 P nerve maturation
GO:0022011 P myelination in peripheral nervous system
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030175 C filopodium
GO:0030336 P negative regulation of cell migration
GO:0032403 F protein-containing complex binding
GO:0033268 C node of Ranvier
GO:0034453 P microtubule anchoring
GO:0042169 F SH2 domain binding
GO:0042383 C sarcolemma
GO:0042802 F identical protein binding
GO:0043034 C costamere
GO:0043409 P negative regulation of MAPK cascade
GO:0043434 P response to peptide hormone
GO:0045121 C membrane raft
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0051393 F alpha-actinin binding
GO:0051898 P negative regulation of protein kinase B signaling
GO:0060441 P epithelial tube branching involved in lung morphogenesis
GO:0060445 P branching involved in salivary gland morphogenesis
GO:0070062 C extracellular exosome
GO:0070938 C contractile ring
GO:0071679 P commissural neuron axon guidance
GO:0071711 P basement membrane organization
GO:1904261 P positive regulation of basement membrane assembly involved in embryonic body morphogenesis
RNA-seq EntryA_BomaMG_comp24977_c0_seq2
Sequence
(Amino Acid)
MGCARYIACALLLLCPLALSRHDDDFAFDNSEEFQVELTANHSEIAKNGLRRLWGVPDTL
AYVGHLFRMEIPKEAFSGKVVAYKVRSDHGRRTPNWLAVDSRHGLISGIPQYQDIGTHTF
TVTAQGTTKGLTATDSFTIEVKKGEDKPHSKYGTCIGDENRLVLLILVDGAFHKIVPRQR
IRALMQLANFMALDGDEFWMEPYKTETHPDTILSGIGSSLRKRGDATTAIYLNVGCGNKL
WDRHKVLVAGLREQSRDGTLEQLLRLPVIGWRLLAVKPTFRVKRQVCRNLLTSFCVLHAV
SVLAWLLPALRIVHPAQ
*(105 a.a.)

- SilkBase 1999-2023 -