SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG15049_internal:A_BomaMG_comp24966_c0_seq2
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000146 F microfilament motor activity
GO:0000166 F nucleotide binding
GO:0001726 C ruffle
GO:0001750 C photoreceptor outer segment
GO:0003774 F cytoskeletal motor activity
GO:0003779 F actin binding
GO:0005509 F calcium ion binding
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005777 C peroxisome
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005882 C intermediate filament
GO:0005884 C actin filament
GO:0006582 P melanin metabolic process
GO:0006810 P transport
GO:0006887 P exocytosis
GO:0006892 P post-Golgi vesicle-mediated transport
GO:0007268 P chemical synaptic transmission
GO:0007601 P visual perception
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0016459 C myosin complex
GO:0017137 F small GTPase binding
GO:0030048 P actin filament-based movement
GO:0030050 P vesicle transport along actin filament
GO:0030073 P insulin secretion
GO:0030141 C secretory granule
GO:0030318 P melanocyte differentiation
GO:0030426 C growth cone
GO:0031585 P regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0031982 C vesicle
GO:0031987 P locomotion involved in locomotory behavior
GO:0032252 P secretory granule localization
GO:0032400 P melanosome localization
GO:0032402 P melanosome transport
GO:0032433 C filopodium tip
GO:0032593 C insulin-responsive compartment
GO:0032869 P cellular response to insulin stimulus
GO:0035371 C microtubule plus-end
GO:0042438 P melanin biosynthetic process
GO:0042470 C melanosome
GO:0042476 P odontogenesis
GO:0042552 P myelination
GO:0042641 C actomyosin
GO:0042759 P long-chain fatty acid biosynthetic process
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043473 P pigmentation
GO:0044822 F RNA binding
GO:0048066 P developmental pigmentation
GO:0050808 P synapse organization
GO:0051643 P endoplasmic reticulum localization
GO:0055037 C recycling endosome
GO:0070062 C extracellular exosome
GO:0072659 P protein localization to plasma membrane
GO:1903358 P regulation of Golgi organization
RNA-seq EntryA_BomaMG_comp24966_c0_seq2
Sequence
(Amino Acid)
RQRVKKMKRQIIVAQAAIRRFLARRQYKRLRIEARSLDHVKTLNKGLENKIISLQQRLGG
AMEKNKLIEPLTAQVADLKAKLELLKLVEIEVKTLKVGIDDKDSIINALRAELQSERDAN
MRLAEAKKGIEDQYNKDRLTWEEESEKLANELKSVKENYTLAIEERDRQHELEKSKLSAD
LESERQSRQKLLSSQYELQERIDTLQRAPPAKEHRRSLSDASSNSQQETAVEDDYGYGSV
RSVDTSRP
(81 a.a.)

- SilkBase 1999-2023 -