| Name | O_BomaMG149_internal:A_BomaMG_comp1645_c1_seq1 |
| Scaffold_id | |
NCBI non-redundant (nr) | PREDICTED:_HEAT_repeat-containing_protein_1_isoform_X2_[Bombyx_mori] |
| Ontology |
| GO:0000462 |
P |
maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
| GO:0005634 |
C |
nucleus |
| GO:0005730 |
C |
nucleolus |
| GO:0006364 |
P |
rRNA processing |
| GO:0030515 |
F |
snoRNA binding |
| GO:0030529 |
C |
ribonucleoprotein complex |
| GO:0030686 |
C |
90S preribosome |
| GO:0032040 |
C |
small-subunit processome |
| GO:0034455 |
C |
t-UTP complex |
| GO:0042254 |
P |
ribosome biogenesis |
| GO:0043066 |
P |
negative regulation of apoptotic process |
| GO:0043487 |
P |
regulation of RNA stability |
| GO:0045943 |
P |
positive regulation of transcription by RNA polymerase I |
|
| RNA-seq Entry | A_BomaMG_comp1645_c1_seq1 |
Sequence (Amino Acid) | PEQVLNHTMEIFTFMGSSVLRHDDAYSFQIITKIIETLIPILVKLDKNIEDHTEKELQQL
QNRVVPVLRIFADVVLHVPEHRRLPLFKKTARNTGTKSIPLGVPSFINRNSYC
(36 a.a.) |