SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG14737_complete:A_BomaMG_comp24888_c0_seq5
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000785 C chromatin
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0009408 P response to heat
GO:0022008 P neurogenesis
GO:0031427 P response to methotrexate
GO:0042742 P defense response to bacterium
GO:0042802 F identical protein binding
GO:0043388 P positive regulation of DNA binding
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0050832 P defense response to fungus
RNA-seq EntryA_BomaMG_comp24888_c0_seq5
Sequence
(Amino Acid)
MFRNRRDNISKNWEEYSSHFGTNSNKNDLDDHLDAMQSDLESLRELLRSDSYALDTNTLM
GLFGSDDPFYGLSYNPADERAKTSNNVDTTKQYPMIDFDWLIGNSEASPAK
*(36 a.a.)

- SilkBase 1999-2023 -