SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG14587_3prime_partial:A_BomaMG_comp24840_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000407 C phagophore assembly site
GO:0000422 P autophagy of mitochondrion
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006497 P protein lipidation
GO:0006501 P C-terminal protein lipidation
GO:0006810 P transport
GO:0006914 P autophagy
GO:0006995 P cellular response to nitrogen starvation
GO:0008134 F transcription factor binding
GO:0008641 F ubiquitin-like modifier activating enzyme activity
GO:0009267 P cellular response to starvation
GO:0010508 P positive regulation of autophagy
GO:0015031 P protein transport
GO:0016236 P macroautophagy
GO:0016239 P positive regulation of macroautophagy
GO:0019778 F Atg12 activating enzyme activity
GO:0019779 F Atg8 activating enzyme activity
GO:0030163 P protein catabolic process
GO:0031401 P positive regulation of protein modification process
GO:0032446 P protein modification by small protein conjugation
GO:0034727 P piecemeal microautophagy of the nucleus
GO:0039521 P suppression by virus of host autophagy
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0044805 P late nucleophagy
GO:0045732 P positive regulation of protein catabolic process
GO:0051607 P defense response to virus
GO:0071455 P cellular response to hyperoxia
GO:1903146 P regulation of autophagy of mitochondrion
RNA-seq EntryA_BomaMG_comp24840_c0_seq1
Sequence
(Amino Acid)
MLEAQNQTEIIQYVPFSSFVHPSFWHTLTEMKLEVDKLKETTKQIFGRFTYRCDIGSVFE
VDGTSFNKTPHLEQQYHHVMGTIMNKNTIEDFKSIDKASLINSIGEMIWSNLRERTWITN
PSALLNFFILSFADLKKFHYYYWFAFPAPSQPTVHMKGRSTKISDYFNNKQLETLSQCYK
SLEENQKNFFVVIKKNDDLSVKKLSEVFDVNSANCIDLDLVSTYFVFADPSNGCNPGWPL
RTFLAALLEYCPELAKSTLQVIGLRSSMNGDFIKSLVFSIEIPQDIKPVESAGWVGWERN
DKGNFGPRLANMSTSMDPVILADTSSDLNIKLMKWRLVPDL
(112 a.a.)

- SilkBase 1999-2023 -