SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG14548_complete:A_BomaMG_comp24833_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001933 P negative regulation of protein phosphorylation
GO:0001965 F G-protein alpha-subunit binding
GO:0003723 F RNA binding
GO:0004721 F phosphoprotein phosphatase activity
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006470 P protein dephosphorylation
GO:0007165 P signal transduction
GO:0008017 F microtubule binding
GO:0010288 P response to lead ion
GO:0016020 C membrane
GO:0016576 P histone dephosphorylation
GO:0016787 F hydrolase activity
GO:0031072 F heat shock protein binding
GO:0042802 F identical protein binding
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043204 C perikaryon
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043278 P response to morphine
GO:0043531 F ADP binding
GO:0046872 F metal ion binding
GO:0051259 P protein complex oligomerization
GO:0051291 P protein heterooligomerization
GO:0060548 P negative regulation of cell death
GO:0070301 P cellular response to hydrogen peroxide
GO:0071276 P cellular response to cadmium ion
GO:0071944 C cell periphery
GO:1901215 P negative regulation of neuron death
GO:1990635 C proximal dendrite
GO:2000324 P positive regulation of glucocorticoid receptor signaling pathway
RNA-seq EntryA_BomaMG_comp24833_c0_seq1
Sequence
(Amino Acid)
MYLHLFSYKLLYPDHFYMSRGNHETLDMNRVYGFRGEVTSKYTSQMADLFTEVYNWLPLA
HCINGRVLVMHGGLFSKDDVTLEDIKNVDRNKQPPEDGIMCELLWSDPQPMQGRSQSKRG
VGCQFGPDVTHNFLQRNKLDYIIRSHEVKNDGYEVAHDGKCITVFSAPNYCDTMGNLGAF
ITMNGKDLVPHFTTYEAVPHPDVKPMAYANSLFNFLCQ
*(72 a.a.)

- SilkBase 1999-2023 -