SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG14530_5prime_partial:A_BomaMG_comp24828_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0001917 C photoreceptor inner segment
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005813 C centrosome
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006816 P calcium ion transport
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007605 P sensory perception of sound
GO:0007626 P locomotory behavior
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016339 P calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0032420 C stereocilium
GO:0032426 C stereocilium tip
GO:0042472 P inner ear morphogenesis
GO:0042491 P inner ear auditory receptor cell differentiation
GO:0045202 C synapse
GO:0045494 P photoreceptor cell maintenance
GO:0046872 F metal ion binding
GO:0048563 P post-embryonic animal organ morphogenesis
GO:0048839 P inner ear development
GO:0050953 P sensory perception of light stimulus
GO:0050957 P equilibrioception
GO:0051480 P regulation of cytosolic calcium ion concentration
GO:0060088 P auditory receptor cell stereocilium organization
GO:0060091 C kinocilium
GO:0060122 P inner ear receptor cell stereocilium organization
RNA-seq EntryA_BomaMG_comp24828_c0_seq1
Sequence
(Amino Acid)
GSVVNVDDLRVHENKDGSVDNTKTDLYLHLVNGRDHSVLEVSQVLKIVDENIEYLDELFK
EFNVLDTQPAEYQPLTAETMATNQTVFWLVWTTLFLAVLLVLTIMMCVSQRADYVRRLKA
ATATAYSSAIPGESDMTIRSTGGRVPNTNKHSTKGSNPIWLHAYENDWYKSDDQLSRSER
DSLDENAVDQDLSNEKPYFITTAAFPSIDSNVTEPQTNQANSDLYQQLEQLKNAKNMETT
EL
*(80 a.a.)

- SilkBase 1999-2023 -