SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG144_3prime_partial:A_BomaMG_comp1597_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		cyclin_dependent_kinase_4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000307 C cyclin-dependent protein kinase holoenzyme complex
GO:0001726 C ruffle
GO:0001954 P positive regulation of cell-matrix adhesion
GO:0002244 P hematopoietic progenitor cell differentiation
GO:0003323 P type B pancreatic cell development
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004693 F cyclin-dependent protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007219 P Notch signaling pathway
GO:0009615 P response to virus
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030097 P hemopoiesis
GO:0030154 P cell differentiation
GO:0030332 F cyclin binding
GO:0033077 P T cell differentiation in thymus
GO:0042063 P gliogenesis
GO:0042127 P regulation of cell population proliferation
GO:0042995 C cell projection
GO:0043697 P cell dedifferentiation
GO:0045638 P negative regulation of myeloid cell differentiation
GO:0045646 P regulation of erythrocyte differentiation
GO:0045668 P negative regulation of osteoblast differentiation
GO:0045786 P negative regulation of cell cycle
GO:0048146 P positive regulation of fibroblast proliferation
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0051301 P cell division
GO:0060218 P hematopoietic stem cell differentiation
GO:2000773 P negative regulation of cellular senescence
RNA-seq EntryA_BomaMG_comp1597_c0_seq1
Sequence
(Amino Acid)
MMSRASTSQSPPVVASINDVSALFQNAQKYEELSLIGTGAYGTVYKARDLHNGGQIVAMK
KVKVALTEDGIPLSTVREIALLRQLEAYRHPNIVRLLDVCHGGQCLERDQQLVLFLVFEH
VEQ
(40 a.a.)

- SilkBase 1999-2023 -