SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG14388_internal:A_BomaMG_comp24792_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007162 P negative regulation of cell adhesion
GO:0007399 P nervous system development
GO:0007416 P synapse assembly
GO:0007626 P locomotory behavior
GO:0010842 P retina layer formation
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030424 C axon
GO:0030426 C growth cone
GO:0042327 P positive regulation of phosphorylation
GO:0042995 C cell projection
GO:0045202 C synapse
GO:0048813 P dendrite morphogenesis
GO:0048842 P positive regulation of axon extension involved in axon guidance
GO:0060060 P post-embryonic retina morphogenesis in camera-type eye
GO:0060219 P camera-type eye photoreceptor cell differentiation
GO:0070593 P dendrite self-avoidance
RNA-seq EntryA_BomaMG_comp24792_c1_seq1
Sequence
(Amino Acid)
GNSAILKCHIPSFVSEYVSVISWIVSEGEEQLELDSNEAHDGKYLVLPSGELHIRDVGPE
DGYKSYQCRTKHRLTGETRLSATKGRLVITEPIGSKSPSFPSGSKLASFQIGL
(36 a.a.)

- SilkBase 1999-2023 -