SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG14077_3prime_partial:A_BomaMG_comp24695_c0_seq6
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000166 F nucleotide binding
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001105 F transcription coactivator activity
GO:0001654 P eye development
GO:0001934 P positive regulation of protein phosphorylation
GO:0003714 F transcription corepressor activity
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0006978 P DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007224 P smoothened signaling pathway
GO:0007628 P adult walking behavior
GO:0008284 P positive regulation of cell population proliferation
GO:0008344 P adult locomotory behavior
GO:0009952 P anterior/posterior pattern specification
GO:0010842 P retina layer formation
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016604 C nuclear body
GO:0016605 C PML body
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0018107 P peptidyl-threonine phosphorylation
GO:0019048 P modulation by virus of host process
GO:0030182 P neuron differentiation
GO:0030218 P erythrocyte differentiation
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0030514 P negative regulation of BMP signaling pathway
GO:0030578 P PML body organization
GO:0032092 P positive regulation of protein binding
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043388 P positive regulation of DNA binding
GO:0043524 P negative regulation of neuron apoptotic process
GO:0045766 P positive regulation of angiogenesis
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046330 P positive regulation of JNK cascade
GO:0046332 F SMAD binding
GO:0046790 F virion binding
GO:0048596 P embryonic camera-type eye morphogenesis
GO:0050882 P voluntary musculoskeletal movement
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051726 P regulation of cell cycle
GO:0060059 P embryonic retina morphogenesis in camera-type eye
GO:0060235 P lens induction in camera-type eye
GO:0060395 P SMAD protein signal transduction
GO:0061072 P iris morphogenesis
GO:0071456 P cellular response to hypoxia
GO:0090575 C RNA polymerase II transcription regulator complex
GO:0097193 P intrinsic apoptotic signaling pathway
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomaMG_comp24695_c0_seq6
Sequence
(Amino Acid)
MLEQNLYDFLKQNKFSPLPLKYIRPILQQVLTALLKLKQLGLIHADLKPENIMLVEPARQ
PYRVKVIDFGSASHVSKAVCNTYLQSRYYRAPEIILGLAFCEAIDMWSLGCVVAELFLGW
PLYPGSSEYDQIRYISQTQGLPTEHMLNSASKTAKFFYRDVDSTYPFWRLKTPEEHELET
GIKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKADRREFIDLLKRMLTMDQERRITP
GEALNHAFVTLAHLVDYAHCNNVKASVQMMEVCRRSGGGVGGAEYG
(94 a.a.)

- SilkBase 1999-2023 -