| Name | O_BomaMG13877_complete:A_BomaMG_comp24642_c0_seq2 |
| Scaffold_id | |
NCBI non-redundant
(nr) | |
| Ontology |
| GO:0000932 |
C |
P-body |
| GO:0003674 |
F |
molecular_function |
| GO:0004518 |
F |
nuclease activity |
| GO:0004519 |
F |
endonuclease activity |
| GO:0005634 |
C |
nucleus |
| GO:0005737 |
C |
cytoplasm |
| GO:0006402 |
P |
mRNA catabolic process |
| GO:0016787 |
F |
hydrolase activity |
| GO:0030308 |
P |
negative regulation of cell growth |
| GO:0042130 |
P |
negative regulation of T cell proliferation |
| GO:0046872 |
F |
metal ion binding |
| GO:0061158 |
P |
3'-UTR-mediated mRNA destabilization |
| GO:0090305 |
P |
nucleic acid phosphodiester bond hydrolysis |
| GO:2000134 |
P |
negative regulation of G1/S transition of mitotic cell cycle |
|
| RNA-seq Entry | A_BomaMG_comp24642_c0_seq2 |
Sequence
(Amino Acid) | MSTDPKLLDALEKVGNVVYTPSREVDGKFITPYDDRYIIQCAAEFDGVIVSGDNYRDLID
ENPTWRYIIKNRLLPFTWVEDMIMFPKDPLGRNGPTLDQFLRHDSPTK
*(35 a.a.) |
