SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG13679_5prime_partial:A_BomaMG_comp24598_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005856 C cytoskeleton
GO:0006289 P nucleotide-excision repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006829 P zinc ion transport
GO:0008324 F cation transmembrane transporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016922 F nuclear receptor binding
GO:0030374 F nuclear receptor coactivator activity
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0055085 P transmembrane transport
GO:0098655 P cation transmembrane transport
RNA-seq EntryA_BomaMG_comp24598_c0_seq1
Sequence
(Amino Acid)
EQLDEINSVLERDFMIRAIHDVKGIDIGSNLIRYKAEVDFDGRALTRSYLEKHDLNALLE
DMKKIDTIDDVETFLLKHGENIVDMLGGEIDRIELKLRKKFPQIRHCDLEIL
*(36 a.a.)

- SilkBase 1999-2023 -