SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG13661_complete:A_BomaMG_comp24587_c1_seq1
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0002039 F p53 binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0006306 P DNA methylation
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0009790 P embryo development
GO:0016279 F protein-lysine N-methyltransferase activity
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0018026 P peptidyl-lysine monomethylation
GO:0018027 P peptidyl-lysine dimethylation
GO:0032259 P methylation
GO:0034968 P histone lysine methylation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0046974 F histone methyltransferase activity (H3-K9 specific)
GO:0046976 F histone methyltransferase activity (H3-K27 specific)
GO:0051567 P histone H3-K9 methylation
GO:0060992 P response to fungicide
GO:0070734 P histone H3-K27 methylation
GO:0070742 F C2H2 zinc finger domain binding
RNA-seq EntryA_BomaMG_comp24587_c1_seq1
Sequence
(Amino Acid)
MCSEAEKAQLFEAIDNNNVEKADVLLSSTVDVNVRSLEVKNRTALHLAAHAGRYDLVALL
VDKHKADVNIEDSEGDIPLQLATDRHHMKIVKFLLSRNSKGREYAAHFLNTDEVEEFFQA
AKANDIQRVTELLDSGVDVNSVDLSDLHRSALHVAAREGHYDLVQLLLERGADMQYEDDT
DECAYHIALNNDHDNIGSLLLKTGYIPDPRDDSSVSSDTDESVSLSFLFN
*(76 a.a.)

- SilkBase 1999-2023 -