SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG1362_complete:A_BomaMG_comp12301_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)		Mitochondrial_import_receptor_subunit_TOM20-like_[Papilio_machaon]
Ontology
GO:0005739 C mitochondrion
GO:0005740 C mitochondrial envelope
GO:0005741 C mitochondrial outer membrane
GO:0005742 C mitochondrial outer membrane translocase complex
GO:0006605 P protein targeting
GO:0006626 P protein targeting to mitochondrion
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0015031 P protein transport
GO:0015266 F protein transmembrane transporter activity
GO:0015450 F protein-transporting ATPase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016031 P tRNA import into mitochondrion
GO:0030150 P protein import into mitochondrial matrix
GO:0030943 F mitochondrion targeting sequence binding
GO:0031307 C integral component of mitochondrial outer membrane
GO:0044233 C mitochondria-associated endoplasmic reticulum membrane
GO:0051082 F unfolded protein binding
GO:0070096 P mitochondrial outer membrane translocase complex assembly
RNA-seq EntryA_BomaMG_comp12301_c0_seq1
Sequence
(Amino Acid)
MMEITRTTLGIAVGIAGTLFLGYCVYFDQQRRKDPLFKKKLRERRLNAQQNASRSRTLGG
PVPDMNDHEAMQRFFLQQIQLGEELLAAGDLEAGVEHLGQAVAVCGQTEQLLSVLQQTMP
APIFHLLLKKLPEVSERLRSSMKARSNVMQEEDVE
*(51 a.a.)

- SilkBase 1999-2023 -