SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG134_internal:A_BomaMG_comp1488_c0_seq1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_glutamate_receptor_ionotropic,_kainate_2-like_[Bombyx_mori]
Ontology
GO:0001662 P behavioral fear response
GO:0004872 F signaling receptor activity
GO:0004970 F ionotropic glutamate receptor activity
GO:0005216 F ion channel activity
GO:0005234 F extracellularly glutamate-gated ion channel activity
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0006886 P intracellular protein transport
GO:0007165 P signal transduction
GO:0007268 P chemical synaptic transmission
GO:0008066 F glutamate receptor activity
GO:0008328 C ionotropic glutamate receptor complex
GO:0014069 C postsynaptic density
GO:0015277 F kainate selective glutamate receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019228 P neuronal action potential
GO:0030054 C cell junction
GO:0030165 F PDZ domain binding
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031624 F ubiquitin conjugating enzyme binding
GO:0031625 F ubiquitin protein ligase binding
GO:0032839 C dendrite cytoplasm
GO:0032983 C kainate selective glutamate receptor complex
GO:0034220 P ion transmembrane transport
GO:0035235 P ionotropic glutamate receptor signaling pathway
GO:0035249 P synaptic transmission, glutamatergic
GO:0042391 P regulation of membrane potential
GO:0042734 C presynaptic membrane
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043025 C neuronal cell body
GO:0043113 P receptor clustering
GO:0043195 C terminal bouton
GO:0043204 C perikaryon
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043525 P positive regulation of neuron apoptotic process
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046328 P regulation of JNK cascade
GO:0048169 P regulation of long-term neuronal synaptic plasticity
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0050804 P modulation of chemical synaptic transmission
GO:0050806 P positive regulation of synaptic transmission
GO:0051402 P neuron apoptotic process
GO:0051967 P negative regulation of synaptic transmission, glutamatergic
GO:0060079 P excitatory postsynaptic potential
GO:0060080 P inhibitory postsynaptic potential
RNA-seq EntryA_BomaMG_comp1488_c0_seq1
Sequence
(Amino Acid)
DVGISILFGAPEPAPPKLFAFMLPFSNAVWICLGFAYLGTSLVLYVVGRLCHEEWQNPYP
CIEDPPALENQFTLANALWFNLGAVLLQGSEIAPVAYGTRAVASAWWLFALVITSSYTAN
LATLLASKSSTDLIHNVEELANNNLGIKYGAKKCGSTYNFFKNSQNPTYHKMYEQMSKEP
MPLSNEIGIKKVENEKY
(64 a.a.)

- SilkBase 1999-2023 -