SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMG13372_complete:A_BomaMG_comp24506_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000814 C ESCRT II complex
GO:0005198 F structural molecule activity
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0006810 P transport
GO:0007293 P germarium-derived egg chamber formation
GO:0008105 P protein localization
GO:0008283 P cell population proliferation
GO:0008593 P regulation of Notch signaling pathway
GO:0010008 C endosome membrane
GO:0010669 P epithelial structure maintenance
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016197 P endosomal transport
GO:0019233 P sensory perception of pain
GO:0030154 P cell differentiation
GO:0030713 P ovarian follicle cell stalk formation
GO:0032509 P endosome transport via multivesicular body sorting pathway
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0042803 F protein homodimerization activity
GO:0042981 P regulation of apoptotic process
GO:0043162 P ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0043328 P protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0045199 P maintenance of epithelial cell apical/basal polarity
GO:0045450 P bicoid mRNA localization
GO:0048803 P imaginal disc-derived male genitalia morphogenesis
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0060429 P epithelium development
GO:0070086 P ubiquitin-dependent endocytosis
GO:0097352 P autophagosome maturation
RNA-seq EntryA_BomaMG_comp24506_c0_seq3
Sequence
(Amino Acid)
MAEISWPWQYNFPPFFTIQPHTETRSKQLEAWEQLITDYLKATKQSTIDIREASNTPLFN
NIEINRKLSQEAILTILEDMAKAGKAAPIDKSKNVWEVYWHSLDEWGNMIYNWACNNGFN
NSVCTLFELREGDNTADQEFHNLDMNVLVKALKSLEAKGRCELMEFDDNQGVKFF
*(57 a.a.)

- SilkBase 1999-2023 -