SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMG13296_5prime_partial:A_BomaMG_comp24485_c0_seq3
Scaffold_id
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005938 C cell cortex
GO:0006468 P protein phosphorylation
GO:0007163 P establishment or maintenance of cell polarity
GO:0007275 P multicellular organism development
GO:0009880 P embryonic pattern specification
GO:0009949 P polarity specification of anterior/posterior axis
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0030010 P establishment of cell polarity
GO:0032035 F myosin II tail binding
GO:0040025 P vulval development
GO:0045167 P asymmetric protein localization involved in cell fate determination
GO:0046872 F metal ion binding
GO:0055059 P asymmetric neuroblast division
GO:0071944 C cell periphery
RNA-seq EntryA_BomaMG_comp24485_c0_seq3
Sequence
(Amino Acid)
KRLSVLGESTGRQKPRIFSSLDIQRRPLDGTTPKHAVGASPQAMLGQGNEEQVKPRVLRF
TWSMKTTSSRDPNEIMAEIRKVLDANNCDYEQRERFLLLCVHGDPNADSLVQWEIEVCKL
PRLSLNGVRFKRISGTSIGFKNIASKIANELKL
*(50 a.a.)

- SilkBase 1999-2023 -